PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G004334_P01
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family HD-ZIP
Protein Properties Length: 732aa    MW: 80141.6 Da    PI: 6.2453
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G004334_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox48.51.5e-15771161756
                        HHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox  17 elFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        ++F+++++p++++r+ L+++lgL+ rq+k+WFqNrR+++k
  GRMZM2G004334_P01  77 RMFKECPHPDENQRAALSRELGLEPRQIKFWFQNRRTQMK 116
                        68***********************************998 PP

2START147.61.1e-462554783206
                        HHHHHHHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EE CS
              START   3 aeeaaqelvkkalaeepgWvkss.....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....ka 79 
                        a +a++el+++a+a+e+ Wvk +     e ++  ++ + f++ ++       ++ea+r+sg+v+m ++ lv  ++d++ +W e ++    ka
  GRMZM2G004334_P01 255 AARAMDELIRLAQAGEQIWVKGVpgdarEVLDVGTYDSLFAKPGAafrppdINVEASRDSGLVFMSAVALVDVFMDTN-KWMEFFPgivsKA 345
                        6899*******************77777333334444444333337899999**************************.************* PP

                        EEEEEECTT.....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEE CS
              START  80 etlevissg.....galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvt 165
                        +t++v+ +g     + l  m+ el  ++p+vp R+  f+Ry++q ++g w+++dvS++ +++        R+++ pSg+li ++sng+skvt
  GRMZM2G004334_P01 346 QTVDVLVNGlggrsESLIMMYEELHIMTPVVPtRELSFLRYCKQIEQGLWAVADVSLEGQRDAH-YGVPSRSRRMPSGCLIADMSNGYSKVT 436
                        *************************************************************987.45557999******************* PP

                        EEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
              START 166 wvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                        wveh++ +  lp   l+r lv sg+a+ga +w+a+lqr ce+
  GRMZM2G004334_P01 437 WVEHMEIEQMLPiNVLYRNLVLSGAAFGAHRWLAALQRACER 478
                        ************999*************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.7E-191031IPR009057Homeodomain-like
SMARTSM003891.4E-771122IPR001356Homeobox domain
PROSITE profilePS5007113.92877118IPR001356Homeobox domain
SuperFamilySSF466894.09E-1377121IPR009057Homeodomain-like
PfamPF000465.7E-1377116IPR001356Homeobox domain
CDDcd000863.77E-1377119No hitNo description
Gene3DG3DSA:1.10.10.603.7E-1977123IPR009057Homeodomain-like
PROSITE patternPS00027093116IPR017970Homeobox, conserved site
SuperFamilySSF559616.6E-30244480No hitNo description
PROSITE profilePS5084846.24244481IPR002913START domain
CDDcd088752.53E-102248477No hitNo description
SMARTSM002344.8E-31253478IPR002913START domain
PfamPF018522.5E-39255478IPR002913START domain
SuperFamilySSF559615.34E-19496724No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 732 aa     Download sequence    Send to blast
MDFGDEPEGS DSQRQRKRYH RHTPRQIQQL EAYDLASFPF LLLLLYSVRP PLWLFVVRRD  60
GLAERNVMAC VLAHDCRMFK ECPHPDENQR AALSRELGLE PRQIKFWFQN RRTQMKAQHE  120
RADNCFLRAE NDKIRCENIT MREALKNVIC PSCGGPPVDE DFFDEQKLRM ENARLKEELD  180
RVSSITSKYL GRPFTQMPPV PTMSVSSLDL SVGGMGSLGG PSLDLDLLSG CSSGLPYQVP  240
APVTEMERPM MVDMAARAMD ELIRLAQAGE QIWVKGVPGD AREVLDVGTY DSLFAKPGAA  300
FRPPDINVEA SRDSGLVFMS AVALVDVFMD TNKWMEFFPG IVSKAQTVDV LVNGLGGRSE  360
SLIMMYEELH IMTPVVPTRE LSFLRYCKQI EQGLWAVADV SLEGQRDAHY GVPSRSRRMP  420
SGCLIADMSN GYSKVTWVEH MEIEQMLPIN VLYRNLVLSG AAFGAHRWLA ALQRACERFA  480
SVATLGVPHH DVAGVTPEGK RSMTKLSQRM VSSFCASLSS SPLQRWTLLS GTTDVSVRVS  540
THRSTDSGQP NGVVLSAATS IWLPVPGDHV FAFVRDENAR SQWDVLSHGN QVQEVSRIPN  600
GSNPGNCISL LRGLNANQNS MLILQESCTD ASGALVVYSP IDIPAANVVM SGEDPSGIPL  660
LPSGFAILPG SGAGASSSAV VPPPGCVVTV AFQILVSNLP SSRLNAESVA TVNSLIGTTV  720
QQIKAALNCA GH
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.1242020.0meristem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G004334
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G004334_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0668130.0BT066813.2 Zea mays full-length cDNA clone ZM_BFb0073D09 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008649207.10.0PREDICTED: homeobox-leucine zipper protein ROC8-like
SwissprotQ69T580.0ROC8_ORYSJ; Homeobox-leucine zipper protein ROC8
TrEMBLA0A096PS860.0A0A096PS86_MAIZE; Uncharacterized protein
STRINGGRMZM2G004334_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29123770
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17920.10.0homeodomain GLABROUS 12